RegulonDB RegulonDB 10.10: Amino acid Sequence
Rac prophage; double-strand break reduction protein Amino Acid Sequence


Size: 69

Fasta

 

>Rac prophage; double-strand break reduction protein E. coli K12. Version NC_000913.3 GI:556503834
MYKITATIEKEGGTPTNWTRYSKSKLTKSECEKMLSGKKEAGVSREQKVKLINFNCEKLQ
SSRIALYSN
              
                            

Download fasta file
RegulonDB