RegulonDB RegulonDB 10.10: Amino acid Sequence
putative inorganic phosphate export protein YjbB Amino Acid Sequence


Size: 543

Fasta

 

>putative inorganic phosphate export protein YjbB E. coli K12. Version NC_000913.3 GI:556503834
MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSRSVEKKPLAFCAGIGVTALVQS
SNATTMLVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDLSWLSPLLIFIGVIFFL
GRKQSRAGQLGRVGIGLGLILLALELIVQAVTPITQANGVQVIFASLTGDILLDALIGAM
FAIISYSSLAAVLLTATLTAAGIISFPVALCLVIGANLGSGLLAMLNNSAANAAARRVAL
GSLLFKLVGSLIILPFVHLLAETMGKLSLPKAELVIYFHVFYNLVRCLVMLPFVDPMARF
CKTIIRDEPELDTQLRPKHLDVSALDTPTLALANAARETLRIGDAMEQMMEGLNKVMHGE
PRQEKELRKLADDINVLYTAIKLYLARMPKEELAEEESRRWAEIIEMSLNLEQASDIVER
MGSEIADKSLAARRAFSLDGLKELDALYEQLLSNLKLAMSVFFSGDVTSARRLRRSKHRF
RILNRRYSHAHVDRLHQQNVQSIETSSLHLGLLGDMQRLNSLFCSVAYSVLEQPDEDEGR
DEY
              
                            

Download fasta file
RegulonDB