RegulonDB RegulonDB 10.10: Amino acid Sequence
peptidase E Amino Acid Sequence


Size: 229

Fasta

 

>peptidase E E. coli K12. Version NC_000913.3 GI:556503834
MELLLLSNSTLPGKAWLEHALPLIAEQLQGRRSAVFIPFAGVTQTWDDYTAKTAAVLAPL
GVSVTGIHSVVDPVAAIENAEIVIVGGGNTFQLLKQCRERGLLAPITDVVKRGALYIGWS
AGANLACPTIRTTNDMPIVDPQGFDALNLFPLQINPHFTNALPEGHKGETREQRIRELLV
VAPELTIIGLPEGNWITVSKGHATLGGPNTTYVFKAGEEAVPLEAGHRF
              
                            

Download fasta file
RegulonDB