RegulonDB RegulonDB 11.0: Amino acid Sequence
capsule biosynthesis GfcC family protein YjbG Amino Acid Sequence


Size: 245

Fasta

 

>capsule biosynthesis GfcC family protein YjbG E. coli K12. Version NC_000913.3 GI:556503834
MIKQTIVALLLSVGASSVFAAGTVKVFSNGSSEAKTLTGAEHLIDLVGQPRLANSWWPGA
VISEELATAAALRQQQALLTRLAEQGADSSADDAAAINALRQQIQALKVTGRQKINLDPD
IVRVAERGNPPLQGNYTLWVGPPPSTVTLFGLISRPGKQPFTPGRDVASYLSDQSLLSGA
DRSYAWVVYPDGRTQKAPVAYWNKRHVEPMPGSIIYVGLADSVWSETPDALNADILQTLT
QRIPQ
              
                            

Download fasta file
RegulonDB