RegulonDB RegulonDB 10.9: Amino acid Sequence
UPF0047 protein YjbQ Amino Acid Sequence


Size: 138

Fasta

 

>UPF0047 protein YjbQ E. coli K12. Version NC_000913.3 GI:556503834
MWYQKTLTLSAKSRGFHLVTDEILNQLADMPRVNIGLLHLLLQHTSASLTLNENCDPTVR
HDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLG
EHRIHGGSRRIIATLQGE
              
                            

Download fasta file
RegulonDB