RegulonDB RegulonDB 10.9: Amino acid Sequence
putative menaquinol-cytochrome c reductase 4Fe-4S subunit Amino Acid Sequence


Size: 223

Fasta

 

>putative menaquinol-cytochrome c reductase 4Fe-4S subunit E. coli K12. Version NC_000913.3 GI:556503834
MTWSRRQFLTGVGVLAAVSGTAGRVVAKTLNINGVRYGMVHDESLCIGCTACMDACREVN
KVPEGVSRLTIIRSEPQGEFPDVKYRFFRKSCQHCDHAPCVDVCPTGASFRDAASGIVDV
NPDLCVGCQYCIAACPYRVRFIHPVTKTADKCDFCRKTNLQAGKLPACVEACPTKALTFG
NLDDPNSEISQLLRQKPTYRYKLALGTKPKLYRVPFKYGEVSQ
              
                            

Download fasta file
RegulonDB