RegulonDB RegulonDB 10.8: Amino acid Sequence
putative menaquinol-cytochrome c reductase subunit NrfD Amino Acid Sequence


Size: 318

Fasta

 

>putative menaquinol-cytochrome c reductase subunit NrfD E. coli K12. Version NC_000913.3 GI:556503834
MTQTSAFHFESLVWDWPIAIYLFLIGISAGLVTLAVLLRRFYPQAGGADSTLLRTTLIVG
PGAVILGLLILVFHLTRPWTFWKLMFHYSFTSVMSMGVMLFQLYMVVLVLWLAKIFEHDL
LALQQRWLPKLGIVQKVLSLLTPVHRGLETLMLVLAVLLGAYTGFLLSALKSYPFLNNPI
LPVLFLFSGISSGAAVALIAMAIRQRSNPHSTEAQFVHRMEIPVVWGEIFLLVAFFVGLA
LGDDGKVRALVAALGGGFWTWWFWLGVAGLGLIVPMLLKPWVNRSSGIPAVLAACGASLV
GVLMLRFFILYAGQLTVA
              
                            

Download fasta file
RegulonDB