RegulonDB RegulonDB 10.9: Amino acid Sequence
putative formate-dependent nitrite reductase complex subunit NrfF Amino Acid Sequence


Size: 127

Fasta

 

>putative formate-dependent nitrite reductase complex subunit NrfF E. coli K12. Version NC_000913.3 GI:556503834
MNKGLLTLLLLFTCFAHAQVVDTWQFANPQQQQQALNIASQLRCPQCQNQNLLESNAPVA
VSMRHQVYSMVAEGKNEVEIIGWMTERYGDFVRYNPPLTGQTLVLWALPVVLLLLMALIL
WRVRAKR
              
                            

Download fasta file
RegulonDB