RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar hook-filament junction protein 1 Amino Acid Sequence


Size: 547

Fasta

 

>flagellar hook-filament junction protein 1 E. coli K12. Version NC_000913.3 GI:556503834
MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV
SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLSTSTSSLATQMQDFFTSLQTL
VSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIASLN
DQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQGST
ARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTLGQ
LALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVLAT
DYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSDAI
VNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSDIG
NKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANAIF
DALINIR
              
                            

Download fasta file
RegulonDB