RegulonDB RegulonDB 11.1: Amino acid Sequence
nucleoside:H+ symporter NupC Amino Acid Sequence


Size: 400

Fasta

 

>nucleoside:H+ symporter NupC E. coli K12. Version NC_000913.3 GI:556503834
MDRVLHFVLALAVVAILALLVSSDRKKIRIRYVIQLLVIEVLLAWFFLNSDVGLGFVKGF
SEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISALIGILQHIRVLPVIIRA
IGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKISRNRMYTMAATAMSTVSMS
IVGAYMTMLEPKYVVAALVLNMFSTFIVLSLINPYRVDASEENIQMSNLHEGQSFFEMLG
EYILAGFKVAIIVAAMLIGFIALIAALNALFATVTGWFGYSISFQGILGYIFYPIAWVMG
VPSSEALQVGSIMATKLVSNEFVAMMDLQKIASTLSPRAEGIISVFLVSFANFSSIGIIA
GAVKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALVL
              
                            

Download fasta file
RegulonDB