RegulonDB RegulonDB 11.0: Amino acid Sequence
flagellar biosynthesis protein FliR Amino Acid Sequence


Size: 261

Fasta

 

>flagellar biosynthesis protein FliR E. coli K12. Version NC_000913.3 GI:556503834
MLQVTSEQWLSWLNLYFWPLLRVLALISTAPILSERSVPKRVKLGLAMMITFAIAPSLPA
NDVPVFSFFALWLAVQQILIGIALGFTMQFAFAAVRTAGEIIGLQMGLSFATFVDPASHL
NMPVLARIMDMLALLLFLTFNGHLWLISLLVDTFHTLPIGGEPLNSNAFLALTKAGSLIF
LNGLMLALPLITLLLTLNLALGLLNRMAPQLSIFVIGFPLTLTVGISLMAALMPLIAPFC
EHLFSEIFNLLADIISELPLI
              
                            

Download fasta file
RegulonDB