RegulonDB RegulonDB 10.9: Amino acid Sequence
dTDP-4-dehydrorhamnose 3,5-epimerase Amino Acid Sequence


Size: 185

Fasta

 

>dTDP-4-dehydrorhamnose 3,5-epimerase E. coli K12. Version NC_000913.3 GI:556503834
MNVIRTEIEDVLILEPRVFGDDRGFFYESFNQSAFEHILGYPVSFVQDNHSRSSKNVLRG
LHFQRGEYAQDKLVRCTHGAVFDVAVDIRPNSVSFGKWVGVLLSADNKQQLWIPKGFAHG
FLVLSDIAEFQYKTTNYYHPESDCGICWNDERIAIDWPQTSGLILSPKDERLFTLDELIR
LKLIA
              
                            

Download fasta file
RegulonDB