RegulonDB RegulonDB 10.9: Amino acid Sequence
putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ Amino Acid Sequence


Size: 196

Fasta

 

>putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ E. coli K12. Version NC_000913.3 GI:556503834
MILKLAKRYGLCGFIRLVRDVLLTRVFYRNCRIIRFPCYIRNDGSINFGENFTSGVGLRL
DAFGRGVIFFSDNVQVNDYVHIASIESVTIGRDTLIASKVFITDHNHGSFKHSDPMSSPN
IPPDMRTLESSAVVIGQRVWLGENVTVLPGTIIGNGVVVGANSVVRGSIPENTVIAGVPA
KIIKKYNHETKLWEKA
              
                            

Download fasta file
RegulonDB