RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1307 domain-containing lipoprotein YehR Amino Acid Sequence


Size: 153

Fasta

 

>DUF1307 domain-containing lipoprotein YehR E. coli K12. Version NC_000913.3 GI:556503834
MKAFNKLFSLVVASVLVFSLAGCGDKEESKKFSANLNGTEIAITYVYKGDKVLKQSSETK
IQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQG
ISGINVSAEDAKKGITMAQMELVMKAAGFKEVK
              
                            

Download fasta file
RegulonDB