RegulonDB RegulonDB 10.9: Amino acid Sequence
high-affinity pyruvate receptor Amino Acid Sequence


Size: 561

Fasta

 

>high-affinity pyruvate receptor E. coli K12. Version NC_000913.3 GI:556503834
MYDFNLVLLLLQQMCVFLVIAWLMSKTPLFIPLMQVTVRLPHKFLCYIVFSIFCIMGTWF
GLHIDDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSMGGMTALSCMISTIVEGLL
GGLVHSILIRRGRTDKVFNPITAGAVTFVAEMVQMLIILAIARPYEDAVRLVSNIAAPMM
VTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEVNSMKVAQVLY
QELDIGAVAITDREKLLAFTGIGDDHHLPGKPISSTYTLKAIETGEVVYADGNEVPYRCS
LHPQCKLGSTLVIPLRGENQRVMGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAGQY
ERQKAMLTQSEIKLLHAQVNPHFLFNALNTIKAVIRRDSEQASQLVQYLSTFFRKNLKRP
SEFVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFTLQPIVENAIKHGT
SQLLDTGRVAISARREGQHLMLEIEDNAGLYQPVTNASGLGMNLVDKRLRERFGDDYGIS
VACEPDSYTRITLRLPWRDEA
              
                            

Download fasta file
RegulonDB