RegulonDB RegulonDB 10.9: Amino acid Sequence
DedA family protein YohD Amino Acid Sequence


Size: 192

Fasta

 

>DedA family protein YohD E. coli K12. Version NC_000913.3 GI:556503834
MDLNTLISQYGYAALVIGSLAEGETVTLLGGVAAHQGLLKFPLVVLSVALGGMIGDQVLY
LCGRRFGGKLLRRFSKHQDKIERAQKLIQRHPYLFVIGTRFMYGFRVIGPTLIGASQLPP
KIFLPLNILGAFAWALIFTTIGYAGGQVIAPWLHNLDQHLKHWVWLILVVVLVVGVRWWL
KRRGKKKPDHQA
              
                            

Download fasta file
RegulonDB