RegulonDB RegulonDB 10.9: Amino acid Sequence
putative oxidoreductase YohF Amino Acid Sequence


Size: 253

Fasta

 

>putative oxidoreductase YohF E. coli K12. Version NC_000913.3 GI:556503834
MAQVAIITASDSGIGKECALLLAQQGFDIGITWHSDEEGAKDTAREVVSHGVRAEIVQLD
LGNLPEGALALEKLIQRLGRIDVLVNNAGAMTKAPFLDMAFDEWRKIFTVDVDGAFLCSQ
IAARQMVKQGQGGRIINITSVHEHTPLPDASAYTAAKHALGGLTKAMALELVRHKILVNA
VAPGAIATPMNGMDDSDVKPDAEPSIPLRRFGATHEIASLVVWLCSEGANYTTGQSLIVD
GGFMLANPQFNPE
              
                            

Download fasta file
RegulonDB