RegulonDB RegulonDB 10.9: Amino acid Sequence
putative multidrug resistance outer membrane protein MdtQ Amino Acid Sequence


Size: 477

Fasta

 

>putative multidrug resistance outer membrane protein MdtQ E. coli K12. Version NC_000913.3 GI:556503834
MNRDSFYPAIACFPLLLMLAGCAPMHETRQALSQQTPAAQVDTALPTALKMVGQTANGGW
SITIINSLP*LTMHYRTHRICRWLNSAFS*LKPRRRQLPLRMVRRSTFRRIWSGKKCRQK
A*WGRLL*TIRPQVRPARGTPTVLLA*RRAGISISGERIGRRLLPAWVRLKHGRRNASKP
ANCWLAA*PACTGSGKPRRR*TRSCSK*KKSRTPLSRPIASYIRTGLLLQLKVWKPILMP
AKPGSSSTMSRGK*KLLRHG*AHLQITRQSH*SLNRSRCRKWQASFLMNWGTPYWPGGQI
CRRRTGTLSHR*APLMRQKRHFILTST*WPSCNRMRCT*AICSVIPRSKWALRQA*RYPF
SIVVVLTPISISQKPKATCLSPATTKRWLKR*MTWRGQPVRFRHWRRKTSIRRKLSAMPC
VW*VLRRRALTRASLLVPASAKPESPRCVSGPMACYCKGSGWMPPFNSLVRWAGGTN
              
                            

Download fasta file
RegulonDB