RegulonDB RegulonDB 10.8: Amino acid Sequence
tRNA-dihydrouridine16 synthase Amino Acid Sequence


Size: 315

Fasta

 

>tRNA-dihydrouridine16 synthase E. coli K12. Version NC_000913.3 GI:556503834
MRVLLAPMEGVLDSLVRELLTEVNDYDLCITEFVRVVDQLLPVKVFHRICPELQNASRTP
SGTLVRVQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNGSGGGATLLKDPELIY
QGAKAMREAVPAHLPVSVKVRLGWDSGEKKFEIADAVQQAGATELVVHGRTKEQGYRAEH
IDWQAIGDIRQRLNIPVIANGEIWDWQSAQQCMAISGCDAVMIGRGALNIPNLSRVVKYN
EPRMPWPEVVALLQKYTRLEKQGDTGLYHVARIKQWLSYLRKEYDEATELFQHVRVLNNS
PDIARAIQAIDIEKL
              
                            

Download fasta file
RegulonDB