RegulonDB RegulonDB 10.8: Amino acid Sequence
PF03788 family membrane protein YohJ Amino Acid Sequence


Size: 132

Fasta

 

>PF03788 family membrane protein YohJ E. coli K12. Version NC_000913.3 GI:556503834
MSKTLNIIWQYLRAFVLIYACLYAGIFIASLLPVTIPGSIIGMLILFVLLALQILPAKWV
NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAVSTLVVFLVVSWSSQLVHG
ERKVVGQKGSEE
              
                            

Download fasta file
RegulonDB