RegulonDB RegulonDB 10.9: Amino acid Sequence
S-formylglutathione hydrolase / S-lactoylglutathione hydrolase Amino Acid Sequence


Size: 278

Fasta

 

>S-formylglutathione hydrolase / S-lactoylglutathione hydrolase E. coli K12. Version NC_000913.3 GI:556503834
MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT
TKAGAQRVAAELGIVLVMPDTSPRGEKVANDDGYDLGQGAGFYLNATQPPWATHYRMYDY
LRDELPALVQSQFNVSDRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVPWG
IKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEAAR
QKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYLLK
              
                            

Download fasta file
RegulonDB