RegulonDB RegulonDB 10.10: Amino acid Sequence
pyrimidine-specific ribonucleoside hydrolase RihB Amino Acid Sequence


Size: 313

Fasta

 

>pyrimidine-specific ribonucleoside hydrolase RihB E. coli K12. Version NC_000913.3 GI:556503834
MEKRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEIN
VPVYAGMPQPIMRQQIVADNIHGETGLDGPVFEPLTRQAESTHAVKYIIDTLMASDGDIT
LVPVGPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTS
GVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDIMNFTLKTQFENYGLAGGPVHD
ATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDTDWFWG
LVEECVRGYIKTH
              
                            

Download fasta file
RegulonDB