RegulonDB RegulonDB 10.9: Amino acid Sequence
pseudouridine-5'-phosphate glycosidase Amino Acid Sequence


Size: 312

Fasta

 

>pseudouridine-5'-phosphate glycosidase E. coli K12. Version NC_000913.3 GI:556503834
MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPFPQNAQTAIEVEETIRKQGA
VPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPFVVAAGKNGATTVASTMIIA
ALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVVCAGAKSILDLGLTTEYLET
FGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVVKWQSGLNGGLVVANPIPEQ
FAMPEHTINAAIDQAVAEAEAQGVIGKESTPFLLARVAELTGGDSLKSNIQLVFNNAILA
SEIAKEYQRLAG
              
                            

Download fasta file
RegulonDB