RegulonDB RegulonDB 10.9: Amino acid Sequence
elongation factor P-like protein YeiP Amino Acid Sequence


Size: 190

Fasta

 

>elongation factor P family protein E. coli K12. Version NC_000913.3 GI:556503834
MPRANEIKKGMVLNYNGKLLLVKDIDIQSPTARGAATLYKMRFSDVRTGLKVEERFKGDD
IVDTVTLTRRYVDFSYVDGNEYVFMDKEDYTPYTFTKDQIEEELLFMPEGGMPDMQVLTW
DGQLLALELPQTVDLEIVETAPGIKGASASARNKPATLSTGLVIQVPEYLSPGEKIRIHI
EERRYMGRAD
              
                            

Download fasta file
RegulonDB