RegulonDB RegulonDB 10.9: Amino acid Sequence
holocytochrome c synthase CcmF component Amino Acid Sequence


Size: 647

Fasta

 

>holocytochrome c synthetase membrane subunit CcmF E. coli K12. Version NC_000913.3 GI:556503834
MMPEIGNGLLCLALGIALLLSVYPLWGVARGDARMMASSRLFAWLLFMSVAGAFLVLVNA
FVVNDFTVTYVASNSNTQLPVWYRVAATWGAHEGSLLLWVLLMSGWTFAVAIFSQRIPLD
IVARVLAIMGMVSVGFLLFILFTSNPFSRTLPNFPIEGRDLNPLLQDPGLIFHPPLLYMG
YVGFSVAFAFAIASLLSGRLDSTYARFTRPWTLAAWIFLTLGIVLGSAWAYYELGWGGWW
FWDPVENASFMPWLVGTALMHSLAVTEQRASFKAWTLLLAISAFSLCLLGTFLVRSGVLV
SVHAFASDPARGMFILAFMVLVIGGSLLLFAARGHKVRSRVNNALWSRESLLLANNVLLV
AAMLVVLLGTLLPLVHKQLGLGSISIGEPFFNTMFTWLMVPFALLLGVGPLVRWGRDRPR
KIRNLLIIAFISTLVLSLLLPWLFESKVVAMTVLGLAMACWIAVLAIAEAALRISRGTKT
TFSYWGMVAAHLGLAVTIVGIAFSQNYSVERDVRMKSGDSVDIHEYRFTFRDVKEVTGPN
WRGGVATIGVTRDGKPETVLYAEKRYYNTAGSMMTEAAIDGGITRDLYAALGEELENGAW
AVRLYYKPFVRWIWAGGLMMALGGLLCLFDPRYRKRVSPQKTAPEAV
              
                            

Download fasta file
RegulonDB