RegulonDB RegulonDB 11.0: Amino acid Sequence
cytochrome c maturation protein B Amino Acid Sequence


Size: 220

Fasta

 

>heme trafficking system membrane protein CcmB E. coli K12. Version NC_000913.3 GI:556503834
MMFWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALL
SSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLG
MDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAM
DAASMHLPVDGYLAILGALLAGTATLSPFATAAALRISIQ
              
                            

Download fasta file
RegulonDB