RegulonDB RegulonDB 10.8: Amino acid Sequence
periplasmic nitrate reductase cytochrome c protein Amino Acid Sequence


Size: 200

Fasta

 

>periplasmic nitrate reductase cytochrome c protein E. coli K12. Version NC_000913.3 GI:556503834
MGNSDRKPGLIKRLWKWWRTPSRLALGTLLLIGFVGGIVFWGGFNTGMEKANTEEFCISC
HEMRNTVYQEYMDSVHYNNRSGVRATCPDCHVPHEFVPKMIRKLKASKELYGKIFGVIDT
PQKFEAHRLTMAQNEWRRMKDNNSQECRNCHNFEYMDTTAQKSVAAKMHDQAVKDGQTCI
DCHKGIAHKLPDMREVEPGF
              
                            

Download fasta file
RegulonDB