RegulonDB RegulonDB 11.0: Amino acid Sequence
ferredoxin-type protein NapH Amino Acid Sequence


Size: 287

Fasta

 

>ferredoxin-type protein NapH E. coli K12. Version NC_000913.3 GI:556503834
MANRKRDAGREALEKKGWWRSHRWLVLRRLCQFFVLGMFLSGPWFGVWILHGNYSSSLLF
DTVPLTDPLMTLQSLASGHLPATVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANW
LRRRFDLNQSATIPRHIRYVLLVVILVGSALTGTLIWEWINPVSLMGRSLVMGFGSGALL
ILALFLFDLLVVEHGWCGHICPVGALYGVLGSKGVITVAATDRQKCNRCMDCFHVCPEPH
VLRAPVLDEQSPVQVTSRDCMTCGRCVDVCSEDVFTITTRWSSGAKS
              
                            

Download fasta file
RegulonDB