RegulonDB RegulonDB 10.9: Amino acid Sequence
FAD:protein FMN transferase Amino Acid Sequence


Size: 351

Fasta

 

>FAD:protein FMN transferase E. coli K12. Version NC_000913.3 GI:556503834
MEISFTRVALLAAALFFVGCDQKPQPAKTHATEVTVLEGKTMGTFWRASIPGIDAKRSAE
LKEKIQTQLDADDQLLSTYKKDSALMRFNDSQSLSPWPVSEAMADIVTTSLRIGAKTDGA
MDITVGPLVNLWGFGPEQQPVQIPSQEQIDAMKAKTGLQHLTVINQSHQQYLQKDLPDLY
VDLSTVGEGYAADHLARLMEQEGISRYLVSVGGALNSRGMNGEGLPWRVAIQKPTDKENA
VQAVVDINGHGISTSGSYRNYYELDGKRLSHVIDPQTGRPIEHNLVSVTVIAPTALEADA
WDTGLMVLGPEKAKEVVRREGLAVYMITKEGDSFKTWMSPQFKSFLVSEKN
              
                            

Download fasta file
RegulonDB