RegulonDB RegulonDB 11.1: Amino acid Sequence
Ni(2+) ABC transporter membrane subunit NikC Amino Acid Sequence


Size: 277

Fasta

 

>Ni(2+) ABC transporter membrane subunit NikC E. coli K12. Version NC_000913.3 GI:556503834
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG
RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS
ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF
VDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL
QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
              
                            

Download fasta file
RegulonDB