RegulonDB RegulonDB 10.9: Amino acid Sequence
polyphenol oxidase YfiH Amino Acid Sequence


Size: 243

Fasta

 

>polyphenol oxidase YfiH E. coli K12. Version NC_000913.3 GI:556503834
MSKLIVPQWPQPKGVAACSSTRIGGVSLPPYDSLNLGAHCGDNPDHVEENRKRLFAAGNL
PSKPVWLEQVHGKDVLKLTGEPYASKRADASYSNTPGTVCAVMTADCLPVLFCNRAGTEV
AAAHAGWRGLCAGVLEETVSCFADNPENILAWLGPAIGPRAFEVGGEVREAFMAVDAKAS
AAFIQHGDKYLADIYQLARQRLANVGVEQIFGGDRCTYTENETFFSYRRDKTTGRMASFI
WLI
              
                            

Download fasta file
RegulonDB