RegulonDB RegulonDB 10.9: Amino acid Sequence
zinc-binding GTPase YeiR Amino Acid Sequence


Size: 328

Fasta

 

>zinc-binding GTPase YeiR E. coli K12. Version NC_000913.3 GI:556503834
MTRTNLITGFLGSGKTTSILHLLAHKDPNEKWAVLVNEFGEVGIDGALLADSGALLKEIP
GGCMCCVNGLPMQVGLNTLLRQGKPDRLLIEPTGLGHPKQILDLLTAPVYEPWIDLRATL
CILDPRLLLDEKSASNENFRDQLAAADIIVANKSDRTTPESEQALQRWWQQNGGDRQLIH
SEHGKVDGHLLDLPRRNLAELPASAAHSHQHVVKKGLAALSLPEHQRWRRSLNSGQGYQA
CGWIFDADTVFDTIGILEWARLAPVERVKGVLRIPEGLVRINRQGDDLHIETQNVAPPDS
RIELISSSEADWNALQSALLKLRLATTA
              
                            

Download fasta file
RegulonDB