RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA-binding transcriptional dual regulator NorR Amino Acid Sequence


Size: 504

Fasta

 

>DNA-binding transcriptional dual regulator NorR E. coli K12. Version NC_000913.3 GI:556503834
MSFSVDVLANIAIELQRGIGHQDRFQRLITTLRQVLECDASALLRYDSRQFIPLAIDGLA
KDVLGRRFALEGHPRLEAIARAGDVVRFPADSELPDPYDGLIPGQESLKVHACVGLPLFA
GQNLIGALTLDGMQPDQFDVFSDEELRLIAALAAGALSNALLIEQLESQNMLPGDATPFE
AVKQTQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLV
YLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNGTLFLDEIGELSLALQAKLL
RVLQYGDIQRVGDDRCLRVDVRVLAATNRDLREEVLAGRFRADLFHRLSVFPLSVPPLRE
RGDDVILLAGYFCEQCRLRQGLSRVVLSAGARNLLQHYSFPGNVRELEHAIHRAVVLARA
TRSGDEVILEAQHFAFPEVTLPTPEVAAVPVVKQNLREATEAFQRETIRQALAQNHHNWA
ACARMLETDVANLHRLAKRLGLKD
              
                            

Download fasta file
RegulonDB