RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF218 domain-containing protein YdcF Amino Acid Sequence


Size: 266

Fasta

 

>DUF218 domain-containing protein YdcF E. coli K12. Version NC_000913.3 GI:556503834
MNITPFPTLSPATIDAINVIGQWLAQDDFSGEVPYQADCVILAGNAVMPTIDAACKIARD
QQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQFWHIPHEKIWIE
DQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDAPRWLSYP
GFVPQLGNNADSVIFINQLQGLWPVERYLSLLTGELPRLRDDSDGYGPRGRDFIVHVDFP
AEVIHAWQTLKHDAVLIEAMESRSLR
              
                            

Download fasta file
RegulonDB