RegulonDB RegulonDB 10.9: Amino acid Sequence
murein hydrolase activator NlpD Amino Acid Sequence


Size: 379

Fasta

 

>murein hydrolase activator NlpD E. coli K12. Version NC_000913.3 GI:556503834
MSAGSPKFTVRRIAALSLVSLWLAGCSDTSNPPAPVSSVNGNAPANTNSGMLITPPPKMG
TTSTAQQPQIQPVQQPQIQATQQPQIQPVQPVAQQPVQMENGRIVYNRQYGNIPKGSYSG
STYTVKKGDTLFYIAWITGNDFRDLAQRNNIQAPYALNVGQTLQVGNASGTPITGGNAIT
QADAAEQGVVIKPAQNSTVAVASQPTITYSESSGEQSANKMLPNNKPTATTVTAPVTVPT
ASTTEPTVSSTSTSTPISTWRWPTEGKVIETFGASEGGNKGIDIAGSKGQAIIATADGRV
VYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSTRLH
FEIRYKGKSVNPLRYLPQR
              
                            

Download fasta file
RegulonDB