RegulonDB RegulonDB 10.9: Amino acid Sequence
lysine/arginine/ornithine ABC transporter / histidine ABC transporter, membrane subunit HisQ Amino Acid Sequence


Size: 228

Fasta

 

>lysine/arginine/ornithine ABC transporter / histidine ABC transporter, membrane subunit HisQ E. coli K12. Version NC_000913.3 GI:556503834
MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL
              
                            

Download fasta file
RegulonDB