RegulonDB RegulonDB 10.9: Amino acid Sequence
[Fe-S] cluster biosynthesis co-chaperone HscB Amino Acid Sequence


Size: 171

Fasta

 

>[Fe-S] cluster biosynthesis co-chaperone HscB E. coli K12. Version NC_000913.3 GI:556503834
MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQT
LRHPLMRAEYLLSLHGFDLASEQHTVRDTAFLMEQLELREELDEIEQAKDEARLESFIKR
VKKMFDTRHQLMVEQLDNETWDAAADTVRKLRFLDKLRSSAEQLEEKLLDF
              
                            

Download fasta file
RegulonDB