RegulonDB RegulonDB 10.8: Amino acid Sequence
L-threonine/L-homoserine exporter Amino Acid Sequence


Size: 295

Fasta

 

>L-threonine/L-homoserine exporter E. coli K12. Version NC_000913.3 GI:556503834
MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFK
PWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPV
DFVWVVLAVLGLWFLLPLGQDVSHVDLTGCALALGAGACWAIYILSGQRAGAEHGPATVA
IGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGT
LMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
              
                            

Download fasta file
RegulonDB