RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidase C92 family protein YaeF Amino Acid Sequence


Size: 274

Fasta

 

>peptidase C92 family protein YaeF E. coli K12. Version NC_000913.3 GI:556503834
MDKPKAYCRLFLPSFLLLSACTVDISQPDPSATAVDAEAKTWAVKFQHQSSFTEQSIKEI
TAPDLKPGDLLFSSSLGVTSFGIRVFSTSSVSHVAIFLGDNNVAEATGAGVQIVSLKKAM
KHSDKLFVLRVPDLTPQQATDITAFANKIKDSGYNYRGIVEFIPFMVTRQMCSLNPFSED
FRQQCVSGLAKAQLSSVGEGDKKSWFCSEFVTDAFAKAGHPLTLAQSGWISPADLMHMRI
GDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR
              
                            

Download fasta file
RegulonDB