RegulonDB RegulonDB 10.9: Amino acid Sequence
D-gluconate kinase, thermosensitive Amino Acid Sequence


Size: 187

Fasta

 

>D-gluconate kinase, thermosensitive E. coli K12. Version NC_000913.3 GI:556503834
MAGESFILMGVSGSGKTLIGSKVAALLSAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPW
LERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRA
GHFMPVALLKSQFEALERPQADEQDIVRIDINHDIANVTEQCRQAVLAIRQNRICAKEGS
ASDQRCE
              
                            

Download fasta file
RegulonDB