RegulonDB RegulonDB 10.10: Amino acid Sequence
Rac prophage; phage superinfection exclusion protein Amino Acid Sequence


Size: 162

Fasta

 

>Rac prophage; phage superinfection exclusion protein E. coli K12. Version NC_000913.3 GI:556503834
MLDVFTPLLKLFANEPLERLMYTIIIFGLTLWLIPKEFTVAFNAYTEIPWLFQIIVFAFS
FVVAISFSRLRAHIQKHYSLLPEQRVLLRLSEKEIAVFKDFLKTGNLIITSPCRNPVMKK
LERKGIIQHQSDSANCSYYLVTEKYSHFMKLFWNSRSRRFNR
              
                            

Download fasta file
RegulonDB