RegulonDB RegulonDB 10.9: Amino acid Sequence
nucleoid-associated protein RdgC Amino Acid Sequence


Size: 303

Fasta

 

>nucleoid-associated protein RdgC E. coli K12. Version NC_000913.3 GI:556503834
MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGWVPPMGSHSDALTHVA
NGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEKDSLKDEVLHSLLPRAF
SRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPVVPLSMENPIELTLTEWV
RSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNHIEAGKVVTKLALDWQQRI
QFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFILMTGELAALIQNLIEGLGGE
AQR
              
                            

Download fasta file
RegulonDB