RegulonDB RegulonDB 10.9: Amino acid Sequence
envelope biogenesis factor Amino Acid Sequence


Size: 259

Fasta

 

>envelope biogenesis factor E. coli K12. Version NC_000913.3 GI:556503834
MLFTLKKVIGNMLLPLPLMLLIIGAGLALLWFSRFQKTGKIFISIGWLALLLLSLQPVAD
RLLRPIESTYPTWNNSQKVDYIVVLGGGYTWNPQWAPSSNLINNSLPRLNEGIRLWRENP
GSKLIFTGGVAKTNTVSTAEVGARVAQSLGVPREQIITLDLPKDTEEEAAAVKQAIGDAP
FLLVTSASHLPRAMIFFQQEGLNPLPAPANQLAIDSPLNPWERAIPSPVWLMHSDRVGYE
TLGRIWQWLKGSSGEPRQE
              
                            

Download fasta file
RegulonDB