RegulonDB RegulonDB 11.1: Amino acid Sequence
tRNA cmo5U34 methyltransferase Amino Acid Sequence


Size: 261

Fasta

 

>tRNA cmo5U34 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MQDRNFDDIAEKFSRNIYGTTKGQLRQAILWQDLDRVLAEMGPQKLRVLDAGGGEGQTAI
KMAERGHQVILCDLSAQMIDRAKQAAEAKGVSDNMQFIHCAAQDVASHLETPVDLILFHA
VLEWVADPRSVLQTLWSVLRPGGVLSLMFYNAHGLLMHNMVAGNFDYVQAGMPKKKKRTL
SPDYPRDPAQVYLWLEEAGWQIMGKTGVRVFHDYLREKHQQRDCYEALLELETRYCRQEP
YITLGRYIHVTARKPQSKDKV
              
                            

Download fasta file
RegulonDB