RegulonDB RegulonDB 10.9: Amino acid Sequence
copper binding protein CutA Amino Acid Sequence


Size: 112

Fasta

 

>copper binding protein CutA E. coli K12. Version NC_000913.3 GI:556503834
MLDEKSSNTASVVVLCTAPDEATAQDLAAKVLAEKLAACATLIPGATSLYYWEGKLEQEY
EVQMILKTTVSHQQALLECLKSHHPYQTPELLVLPVTHGDTDYLSWLNASLR
              
                            

Download fasta file
RegulonDB