RegulonDB RegulonDB 11.0: Amino acid Sequence
transcription antiterminator and regulator of RNA stability CspE Amino Acid Sequence


Size: 69

Fasta

 

>transcription antiterminator and regulator of RNA stability E. coli K12. Version NC_000913.3 GI:556503834
MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKG
PSAANVIAL
              
                            

Download fasta file
RegulonDB