RegulonDB RegulonDB 10.9: Amino acid Sequence
curved DNA-binding protein Amino Acid Sequence


Size: 306

Fasta

 

>curved DNA-binding protein E. coli K12. Version NC_000913.3 GI:556503834
MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQ
RRAEYDQMWQHRNDPQFNRQFHHGDGQSFNAEDFDDIFSSIFGQHARQSRQRPATRGHDI
EIEVAVFLEETLTEHKRTISYNLPVYNAFGMIEQEIPKTLNVKIPAGVGNGQRIRLKGQG
TPGENGGPNGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKESILLT
IPPGSQAGQRLRVKGKGLVSKKQTGDLYAVLKIVMPPKPDENTAALWQQLADAQSSFDPR
KDWGKA
              
                            

Download fasta file
RegulonDB