RegulonDB RegulonDB 10.9: Amino acid Sequence
trimethylamine-N-oxide reductase-specific chaperone Amino Acid Sequence


Size: 199

Fasta

 

>trimethylamine-N-oxide reductase-specific chaperone E. coli K12. Version NC_000913.3 GI:556503834
MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKSEPPLTAAVNELENR
IATLTVRDDARLELAADFCGLFLMTDKQAALPYASAYKQDEQEIKRLLVEAGMETSGNFN
EPADHLAIYLELLSHLHFSLGEGTVPARRIDSLRQKTLTALWQWLPEFVARCRQYDSFGF
YAALSQLLLVLVECDHQNR
              
                            

Download fasta file
RegulonDB