RegulonDB RegulonDB 10.9: Amino acid Sequence
uncharacterized protein YccE Amino Acid Sequence


Size: 418

Fasta

 

>uncharacterized protein YccE E. coli K12. Version NC_000913.3 GI:556503834
MGSNIHGISCTANNYLKQAWNDIKNEYEKNQTYSITLFENTLVCFMRLYNELRRKVNEED
TPCLECESLEKEFEEMQNDNDLSLFMRILRTNDTQIYSGVSGGITYTIQYVRDIDIVRVS
LPGRASESITDFKGYYWYNFMEYIENINACDDVFSEYCFDDENISVQPERINTPGISDLD
SDIDLSGISFIQRETNQALGLKYAPVDGDGYCLLRAILVLKQHDYSWALVSYKMQKEVYN
EFIKMVDKKTIEALVDTAFYNLREDVKTLFGVDLQSDNQIQGQSSLMSWSFLFFKKQFID
SCLNNEKCILHLPEFIFNDNKNLLALDTDTSDRIKAVKNFLVVLSDSICSLFIVNSNVAS
ISLGNESFSTDEDLEYGYLMNTGNHYDVYLPPELFAQAYKLNNKEMNAQLDYLNRYAI
              
                            

Download fasta file
RegulonDB