RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; cold shock-like protein CspB Amino Acid Sequence


Size: 71

Fasta

 

>Qin prophage; cold shock-like protein CspB E. coli K12. Version NC_000913.3 GI:556503834
MSNKMTGLVKWFNADKGFGFISPVDGSKDVFVHFSAIQNDNYRTLFEGQKVTFSIESGAK
GPAAANVIITD
              
                            

Download fasta file
RegulonDB